PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22684A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 343aa    MW: 37119.6 Da    PI: 6.6282
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22684AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-121455148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++l+ +++ +G g+W++ +++ g +     c++rw +yl
  Oropetium_20150105_22684A 14 KGPWTPEEDQKLLAYIEHHGHGCWRSLPAKAG-T-----CRLRWTNYL 55
                               79******************************.4.....*******97 PP

2Myb_DNA-binding53.17.3e-1761106148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Oropetium_20150105_22684A  61 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 106
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-20558IPR009057Homeodomain-like
PROSITE profilePS5129414.536955IPR017930Myb domain
SuperFamilySSF466897.26E-2611102IPR009057Homeodomain-like
SMARTSM007178.2E-101357IPR001005SANT/Myb domain
PfamPF002492.7E-111455IPR001005SANT/Myb domain
PROSITE profilePS5129425.89156110IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2659110IPR009057Homeodomain-like
SMARTSM007171.2E-1660108IPR001005SANT/Myb domain
PfamPF002493.9E-1661106IPR001005SANT/Myb domain
CDDcd001676.10E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLAYIE HHGHGCWRSL PAKAGTCRLR WTNYLRPDIK  60
RGKFSLQEEQ TIIQLHALLG NRWSAIATHL PKRTDNEIKN YWNTHLKKRL AKMGIDPVTH  120
KSRSDALAVG VGEQHVKAAA HLSHTAQWES ARLEAEARLA REAKLRALAA STSSAPPALQ  180
PSAPAVVPGG LESPTSTLSF SESAATLASV LEAHAHGAVV ARVAMQQPMQ QQAAFEEACK  240
EQEQQQHWPD FDTGFATAGF TGLLLADGSL SQDQIRPAAA RDHAEAAAND AGLQAETSEE  300
EERNYWDTIL LNLVNSSSSA SLPTTTVAPA TEAYSSPAAL EF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24121105108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3603781e-131AK360378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1116O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975862.11e-140PREDICTED: myb-related protein Myb4-like
TrEMBLI1PLX91e-140I1PLX9_ORYGL; Uncharacterized protein
TrEMBLK3Y8111e-140K3Y811_SETIT; Uncharacterized protein
STRINGORGLA04G0119800.11e-140(Oryza glaberrima)
STRINGSi010352m1e-140(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-84myb domain protein 16